mirror of
https://github.com/Froxlor/Froxlor.git
synced 2024-09-22 10:57:34 +00:00
b8952259ba
Signed-off-by: Michael Kaufmann (d00p) <d00p@froxlor.org>
805 lines
32 KiB
PHP
805 lines
32 KiB
PHP
<?php
|
|
|
|
/**
|
|
* This file is part of the Froxlor project.
|
|
* Copyright (c) 2003-2009 the SysCP Team (see authors).
|
|
* Copyright (c) 2010 the Froxlor Team (see authors).
|
|
*
|
|
* For the full copyright and license information, please view the COPYING
|
|
* file that was distributed with this source code. You can also view the
|
|
* COPYING file online at http://files.froxlor.org/misc/COPYING.txt
|
|
*
|
|
* @copyright (c) the authors
|
|
* @author Florian Lippert <flo@syscp.org> (2003-2009)
|
|
* @author Froxlor team <team@froxlor.org> (2010-)
|
|
* @license GPLv2 http://files.froxlor.org/misc/COPYING.txt
|
|
* @package Panel
|
|
*
|
|
*/
|
|
|
|
define('AREA', 'customer');
|
|
require './lib/init.php';
|
|
|
|
if(isset($_POST['id'])) {
|
|
$id = intval($_POST['id']);
|
|
} elseif(isset($_GET['id'])) {
|
|
$id = intval($_GET['id']);
|
|
}
|
|
|
|
if($page == 'overview') {
|
|
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains");
|
|
eval("echo \"" . getTemplate("domains/domains") . "\";");
|
|
} elseif($page == 'domains') {
|
|
if($action == '') {
|
|
$log->logAction(USR_ACTION, LOG_NOTICE, "viewed customer_domains::domains");
|
|
$fields = array(
|
|
'd.domain' => $lng['domains']['domainname']
|
|
);
|
|
$paging = new paging($userinfo, TABLE_PANEL_DOMAINS, $fields, $settings['panel']['paging'], $settings['panel']['natsorting']);
|
|
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`caneditdomain`, `d`.`iswildcarddomain`, `d`.`parentdomainid`, `ad`.`id` AS `aliasdomainid`, `ad`.`domain` AS `aliasdomain`, `da`.`id` AS `domainaliasid`, `da`.`domain` AS `domainalias` FROM `" . TABLE_PANEL_DOMAINS . "` `d`
|
|
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `ad` ON `d`.`aliasdomain`=`ad`.`id`
|
|
LEFT JOIN `" . TABLE_PANEL_DOMAINS . "` `da` ON `da`.`aliasdomain`=`d`.`id`
|
|
WHERE `d`.`customerid`= :customerid
|
|
AND `d`.`email_only`='0'
|
|
AND `d`.`id` <> :standardsubdomain " . $paging->getSqlWhere(true) . " " . $paging->getSqlOrderBy() . " " . $paging->getSqlLimit()
|
|
);
|
|
Database::pexecute($domains_stmt, array("customerid" => $userinfo['customerid'], "standardsubdomain" => $userinfo['standardsubdomain']));
|
|
$paging->setEntries(Database::num_rows());
|
|
$sortcode = $paging->getHtmlSortCode($lng);
|
|
$arrowcode = $paging->getHtmlArrowCode($filename . '?page=' . $page . '&s=' . $s);
|
|
$searchcode = $paging->getHtmlSearchCode($lng);
|
|
$pagingcode = $paging->getHtmlPagingCode($filename . '?page=' . $page . '&s=' . $s);
|
|
$domains = '';
|
|
$parentdomains_count = 0;
|
|
$domains_count = 0;
|
|
$domain_array = array();
|
|
|
|
while($row = $domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
|
$row['domain'] = $idna_convert->decode($row['domain']);
|
|
$row['aliasdomain'] = $idna_convert->decode($row['aliasdomain']);
|
|
$row['domainalias'] = $idna_convert->decode($row['domainalias']);
|
|
|
|
if($row['parentdomainid'] == '0' && $row['caneditdomain'] == '1') {
|
|
$parentdomains_count++;
|
|
}
|
|
|
|
/**
|
|
* check for set ssl-certs to show different state-icons
|
|
*/
|
|
// nothing (ssl_global)
|
|
$row['domain_hascert'] = 0;
|
|
$ssl_stmt = Database::prepare("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid` = :domainid");
|
|
Database::pexecute($ssl_stmt, array("domainid" => $row['id']));
|
|
$ssl_result = $ssl_stmt->fetch(PDO::FETCH_ASSOC);
|
|
if (is_array($ssl_result) && isset($ssl_result['ssl_cert_file']) && $ssl_result['ssl_cert_file'] != '') {
|
|
// own certificate (ssl_customer_green)
|
|
$row['domain_hascert'] = 1;
|
|
} else {
|
|
// check if it's parent has one set (shared)
|
|
if ($row['parentdomainid'] != 0) {
|
|
$ssl_stmt = Database::prepare("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` WHERE `domainid` = :domainid");
|
|
Database::pexecute($ssl_stmt, array("domainid" => $row['parentdomainid']));
|
|
$ssl_result = $ssl_stmt->fetch(PDO::FETCH_ASSOC);
|
|
if (is_array($ssl_result) && isset($ssl_result['ssl_cert_file']) && $ssl_result['ssl_cert_file'] != '') {
|
|
// parent has a certificate (ssl_shared)
|
|
$row['domain_hascert'] = 2;
|
|
}
|
|
}
|
|
}
|
|
|
|
$domains_count++;
|
|
$domain_array[$row['domain']] = $row;
|
|
}
|
|
|
|
ksort($domain_array);
|
|
$domain_id_array = array();
|
|
foreach($domain_array as $sortkey => $row) {
|
|
$domain_id_array[$row['id']] = $sortkey;
|
|
}
|
|
|
|
$domain_sort_array = array();
|
|
foreach($domain_array as $sortkey => $row) {
|
|
if($row['parentdomainid'] == 0) {
|
|
$domain_sort_array[$sortkey][$sortkey] = $row;
|
|
} else {
|
|
$domain_sort_array[$domain_id_array[$row['parentdomainid']]][$sortkey] = $row;
|
|
}
|
|
}
|
|
|
|
$domain_array = array();
|
|
|
|
if($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') {
|
|
ksort($domain_sort_array);
|
|
} elseif($paging->sortfield == 'd.domain' && $paging->sortorder == 'desc') {
|
|
krsort($domain_sort_array);
|
|
}
|
|
|
|
$i = 0;
|
|
foreach($domain_sort_array as $sortkey => $domain_array) {
|
|
if($paging->checkDisplay($i)) {
|
|
$row = htmlentities_array($domain_array[$sortkey]);
|
|
if($settings['system']['awstats_enabled'] == '1') {
|
|
$statsapp = 'awstats';
|
|
} else {
|
|
$statsapp = 'webalizer';
|
|
}
|
|
eval("\$domains.=\"" . getTemplate("domains/domains_delimiter") . "\";");
|
|
|
|
if($paging->sortfield == 'd.domain' && $paging->sortorder == 'asc') {
|
|
ksort($domain_array);
|
|
} elseif($paging->sortfield == 'd.domain' && $paging->sortorder == 'desc') {
|
|
krsort($domain_array);
|
|
}
|
|
|
|
foreach($domain_array as $row) {
|
|
if(strpos($row['documentroot'], $userinfo['documentroot']) === 0) {
|
|
$row['documentroot'] = makeCorrectDir(substr($row['documentroot'], strlen($userinfo['documentroot'])));
|
|
}
|
|
|
|
// get ssl-ips if activated
|
|
$show_ssledit = false;
|
|
if ($settings['system']['use_ssl'] == '1' && domainHasSslIpPort($row['id']) && $row['caneditdomain'] == '1') {
|
|
$show_ssledit = true;
|
|
}
|
|
$row = htmlentities_array($row);
|
|
eval("\$domains.=\"" . getTemplate("domains/domains_domain") . "\";");
|
|
}
|
|
}
|
|
|
|
$i+= count($domain_array);
|
|
}
|
|
|
|
eval("echo \"" . getTemplate("domains/domainlist") . "\";");
|
|
} elseif($action == 'delete' && $id != 0) {
|
|
$stmt = Database::prepare("SELECT `id`, `customerid`, `domain`, `documentroot`, `isemaildomain`, `parentdomainid` FROM `" . TABLE_PANEL_DOMAINS . "`
|
|
WHERE `customerid` = :customerid
|
|
AND `id` = :id"
|
|
);
|
|
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
|
$result = $stmt->fetch(PDO::FETCH_ASSOC);
|
|
|
|
$alias_stmt = Database::prepare("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain` = :aliasdomain");
|
|
Database::pexecute($alias_stmt, array("aliasdomain" => $id));
|
|
$alias_check = $alias_stmt->fetch(PDO::FETCH_ASSOC);
|
|
|
|
if(isset($result['parentdomainid']) && $result['parentdomainid'] != '0' && $alias_check['count'] == 0) {
|
|
if(isset($_POST['send']) && $_POST['send'] == 'send') {
|
|
if($result['isemaildomain'] == '1') {
|
|
$emails_stmt = Database::prepare("SELECT COUNT(`id`) AS `count` FROM `" . TABLE_MAIL_VIRTUAL . "`
|
|
WHERE `customerid` = :customerid
|
|
AND `domainid` = :domainid"
|
|
);
|
|
Database::pexecute($emails_stmt, array("customerid" => $userinfo['customerid'], "domainid" => $id));
|
|
$emails = $emails_stmt->fetch(PDO::FETCH_ASSOC);
|
|
|
|
if($emails['count'] != '0') {
|
|
standard_error('domains_cantdeletedomainwithemail');
|
|
}
|
|
}
|
|
|
|
/*
|
|
* check for APS packages used with this domain, #110
|
|
*/
|
|
if(domainHasApsInstances($id)) {
|
|
standard_error('domains_cantdeletedomainwithapsinstances');
|
|
}
|
|
|
|
$log->logAction(USR_ACTION, LOG_INFO, "deleted subdomain '" . $idna_convert->decode($result['domain']) . "'");
|
|
$stmt = Database::prepare("DELETE FROM `" . TABLE_PANEL_DOMAINS . "` WHERE
|
|
`customerid` = :customerid
|
|
AND `id` = :id"
|
|
);
|
|
Database::pexecute($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
|
|
|
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
|
SET `subdomains_used` = `subdomains_used` - 1
|
|
WHERE `customerid` = :customerid"
|
|
);
|
|
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
|
|
|
inserttask('1');
|
|
|
|
// Using nameserver, insert a task which rebuilds the server config
|
|
inserttask('4');
|
|
|
|
redirectTo($filename, Array('page' => $page, 's' => $s));
|
|
} else {
|
|
ask_yesno('domains_reallydelete', $filename, array('id' => $id, 'page' => $page, 'action' => $action), $idna_convert->decode($result['domain']));
|
|
}
|
|
} else {
|
|
standard_error('domains_cantdeletemaindomain');
|
|
}
|
|
} elseif($action == 'add') {
|
|
if($userinfo['subdomains_used'] < $userinfo['subdomains'] || $userinfo['subdomains'] == '-1') {
|
|
if(isset($_POST['send']) && $_POST['send'] == 'send') {
|
|
$subdomain = $idna_convert->encode(preg_replace(Array('/\:(\d)+$/', '/^https?\:\/\//'), '', validate($_POST['subdomain'], 'subdomain', '', 'subdomainiswrong')));
|
|
$domain = $idna_convert->encode($_POST['domain']);
|
|
$domain_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "`
|
|
WHERE `domain` = :domain
|
|
AND `customerid` = :customerid
|
|
AND `parentdomainid` = '0'
|
|
AND `email_only` = '0'
|
|
AND `caneditdomain` = '1'"
|
|
);
|
|
$domain_check = Database::pexecute_first($domain_stmt, array("domain" => $domain, "customerid" => $userinfo['customerid']));
|
|
|
|
$completedomain = $subdomain . '.' . $domain;
|
|
$completedomain_stmt = Database::prepare("SELECT * FROM `" . TABLE_PANEL_DOMAINS . "`
|
|
WHERE `domain` = :domain
|
|
AND `customerid` = :customerid
|
|
AND `email_only` = '0'
|
|
AND `caneditdomain` = '1'"
|
|
);
|
|
$completedomain_check = Database::pexecute_first($completedomain_stmt, array("domain" => $completedomain, "customerid" => $userinfo['customerid']));
|
|
|
|
$aliasdomain = intval($_POST['alias']);
|
|
$aliasdomain_check = array('id' => 0);
|
|
$_doredirect = false;
|
|
|
|
if($aliasdomain != 0) {
|
|
// also check ip/port combination to be the same, #176
|
|
$aliasdomain_stmt = Database::prepare("SELECT `d`.`id` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip`
|
|
WHERE `d`.`aliasdomain` IS NULL
|
|
AND `d`.`id` = :id
|
|
AND `c`.`standardsubdomain` <> `d`.`id`
|
|
AND `d`.`customerid` = :customerid
|
|
AND `c`.`customerid` = `d`.`customerid`
|
|
AND `d`.`id` = `dip`.`id_domain`
|
|
AND `dip`.`id_ipandports`
|
|
IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."`
|
|
WHERE `id_domain` = :id )
|
|
GROUP BY `d`.`domain
|
|
ORDER BY `d`.`domain` ASC;"
|
|
);
|
|
$aliasdomain_check = Database::pexecute_first($aliasdomain_stmt, array("id" => $aliasdomain, "customerid" => $userinfo['customerid']));
|
|
}
|
|
|
|
if(isset($_POST['url']) && $_POST['url'] != '' && validateUrl($idna_convert->encode($_POST['url']))) {
|
|
$path = $_POST['url'];
|
|
$_doredirect = true;
|
|
} else {
|
|
$path = validate($_POST['path'], 'path');
|
|
}
|
|
|
|
if(!preg_match('/^https?\:\/\//', $path) || !validateUrl($idna_convert->encode($path))) {
|
|
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
|
|
// set default path to subdomain or domain name
|
|
if((($path == '') || ($path == '/')) && $settings['system']['documentroot_use_default_value'] == 1) {
|
|
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $completedomain);
|
|
} else {
|
|
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
|
}
|
|
if (strstr($path, ":") !== FALSE) {
|
|
standard_error('pathmaynotcontaincolon');
|
|
}
|
|
} else {
|
|
$_doredirect = true;
|
|
}
|
|
|
|
$openbasedir_path = '0';
|
|
if (isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') {
|
|
$openbasedir_path = '1';
|
|
}
|
|
|
|
$ssl_redirect = '0';
|
|
if (isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') {
|
|
// a ssl-redirect only works of there actually is a
|
|
// ssl ip/port assigned to the domain
|
|
if (domainHasSslIpPort($domain_check['id']) == true) {
|
|
$ssl_redirect = '1';
|
|
} else {
|
|
standard_error('sslredirectonlypossiblewithsslipport');
|
|
}
|
|
}
|
|
|
|
if($path == '') {
|
|
standard_error('patherror');
|
|
} elseif($subdomain == '') {
|
|
standard_error(array('stringisempty', 'domainname'));
|
|
} elseif($subdomain == 'www' && $domain_check['wwwserveralias'] == '1') {
|
|
standard_error('wwwnotallowed');
|
|
} elseif($domain == '') {
|
|
standard_error('domaincantbeempty');
|
|
} elseif(strtolower($completedomain_check['domain']) == strtolower($completedomain)) {
|
|
standard_error('domainexistalready', $completedomain);
|
|
} elseif(strtolower($domain_check['domain']) != strtolower($domain)) {
|
|
standard_error('maindomainnonexist', $domain);
|
|
} elseif($aliasdomain_check['id'] != $aliasdomain) {
|
|
standard_error('domainisaliasorothercustomer');
|
|
} else {
|
|
// get the phpsettingid from parentdomain, #107
|
|
$phpsid_stmt = Database::prepare("SELECT `phpsettingid` FROM `".TABLE_PANEL_DOMAINS."`
|
|
WHERE `id` = :id"
|
|
);
|
|
Database::pexecute($phpsid_stmt, array("id" => $domain_check['id']));
|
|
$phpsid_result = $phpsid_stmt->fetch(PDO::FETCH_ASSOC);
|
|
|
|
if(!isset($phpsid_result['phpsettingid']) || (int)$phpsid_result['phpsettingid'] <= 0) {
|
|
// assign default config
|
|
$phpsid_result['phpsettingid'] = 1;
|
|
}
|
|
|
|
$stmt = Database::prepare("INSERT INTO `" . TABLE_PANEL_DOMAINS . "` SET
|
|
`customerid` = :customerid,
|
|
`domain` = :domain,
|
|
`documentroot` = :documentroot,
|
|
`aliasdomain` = :aliasdomain,
|
|
`parentdomainid` = :parentdomainid,
|
|
`isemaildomain` = :isemaildomain,
|
|
`openbasedir` = :openbasedir,
|
|
`openbasedir_path` = :openbasedir_path,
|
|
`speciallogfile` = :speciallogfile,
|
|
`specialsettings` = :specialsettings,
|
|
`ssl_redirect` = :ssl_redirect,
|
|
`phpsettingid` = :phpsettingid"
|
|
);
|
|
$params = array(
|
|
"customerid" => $userinfo['customerid'],
|
|
"domain" => $completedomain,
|
|
"documentroot" => $path,
|
|
"aliasdomain" => $aliasdomain != 0 ? $aliasdomain : null,
|
|
"parentdomainid" => $domain_check['id'],
|
|
"isemaildomain" => $domain_check['subcanemaildomain'] == '3' ? '1' : '0',
|
|
"openbasedir" => $domain_check['openbasedir'],
|
|
"openbasedir_path" => $openbasedir_path,
|
|
"speciallogfile" => $domain_check['speciallogfile'],
|
|
"specialsettings" => $domain_check['specialsettings'],
|
|
"ssl_redirect" => $ssl_redirect,
|
|
"phpsettingid" => $phpsid_result['phpsettingid']
|
|
);
|
|
Database::pexecute($stmt, $params);
|
|
|
|
if($_doredirect) {
|
|
$did = Database::lastInsertId();
|
|
$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : $settings['customredirect']['default'];
|
|
addRedirectToDomain($did, $redirect);
|
|
}
|
|
|
|
$stmt = Database::prepare("INSERT INTO `".TABLE_DOMAINTOIP."`
|
|
(`id_domain`, `id_ipandports`)
|
|
SELECT LAST_INSERT_ID(), `id_ipandports`
|
|
FROM `".TABLE_DOMAINTOIP."`
|
|
WHERE `id_domain` = :id_domain"
|
|
);
|
|
Database::pexecute($stmt, array("id_domain" => $domain_check['id']));
|
|
|
|
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_CUSTOMERS . "`
|
|
SET `subdomains_used` = `subdomains_used` + 1
|
|
WHERE `customerid` = :customerid"
|
|
);
|
|
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
|
|
|
$log->logAction(USR_ACTION, LOG_INFO, "added subdomain '" . $completedomain . "'");
|
|
inserttask('1');
|
|
|
|
// Using nameserver, insert a task which rebuilds the server config
|
|
inserttask('4');
|
|
|
|
redirectTo($filename, array('page' => $page, 's' => $s));
|
|
}
|
|
} else {
|
|
$stmt = Database::prepare("SELECT `id`, `domain`, `documentroot`, `ssl_redirect`,`isemaildomain` FROM `" . TABLE_PANEL_DOMAINS . "`
|
|
WHERE `customerid` = :customerid
|
|
AND `parentdomainid` = '0'
|
|
AND `email_only` = '0'
|
|
AND `caneditdomain` = '1'
|
|
ORDER BY `domain` ASC"
|
|
);
|
|
Database::pexecute($stmt, array("customerid" => $userinfo['customerid']));
|
|
$domains = '';
|
|
|
|
while($row = $stmt->fetch(PDO::FETCH_ASSOC)) {
|
|
$domains .= makeoption($idna_convert->decode($row['domain']), $row['domain']);
|
|
}
|
|
|
|
$aliasdomains = makeoption($lng['domains']['noaliasdomain'], 0, NULL, true);
|
|
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_CUSTOMERS . "` `c`
|
|
WHERE `d`.`aliasdomain` IS NULL
|
|
AND `d`.`id` <> `c`.`standardsubdomain`
|
|
AND `d`.`customerid`=`c`.`customerid`
|
|
AND `d`.`email_only`='0'
|
|
AND `d`.`customerid`= :customerid
|
|
ORDER BY `d`.`domain` ASC"
|
|
);
|
|
Database::pexecute($domains_stmt, array("customerid" => $userinfo['customerid']));
|
|
|
|
while($row_domain = $domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
|
$aliasdomains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id']);
|
|
}
|
|
|
|
$redirectcode = '';
|
|
if($settings['customredirect']['enabled'] == '1') {
|
|
$codes = getRedirectCodesArray();
|
|
foreach($codes as $rc) {
|
|
$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $settings['customredirect']['default']);
|
|
}
|
|
}
|
|
|
|
// check if we at least have one ssl-ip/port, #1179
|
|
$ssl_ipsandports = '';
|
|
$ssl_ip_stmt = Database::prepare("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
|
|
Database::pexecute($ssl_ip_stmt);
|
|
$resultX = $ssl_ip_stmt->fetch(PDO::FETCH_ASSOC);
|
|
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
|
|
$ssl_ipsandports = 'notempty';
|
|
}
|
|
|
|
$openbasedir = makeoption($lng['domain']['docroot'], 0, NULL, true) . makeoption($lng['domain']['homedir'], 1, NULL, true);
|
|
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
|
|
|
|
$subdomain_add_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_add.php';
|
|
$subdomain_add_form = htmlform::genHTMLForm($subdomain_add_data);
|
|
|
|
$title = $subdomain_add_data['domain_add']['title'];
|
|
$image = $subdomain_add_data['domain_add']['image'];
|
|
|
|
eval("echo \"" . getTemplate("domains/domains_add") . "\";");
|
|
}
|
|
}
|
|
} elseif($action == 'edit' && $id != 0) {
|
|
|
|
$stmt = Database::prepare("SELECT `d`.`id`, `d`.`customerid`, `d`.`domain`, `d`.`documentroot`, `d`.`isemaildomain`, `d`.`wwwserveralias`, `d`.`iswildcarddomain`,
|
|
`d`.`parentdomainid`, `d`.`ssl_redirect`, `d`.`aliasdomain`, `d`.`openbasedir`, `d`.`openbasedir_path`, `pd`.`subcanemaildomain`
|
|
FROM `" . TABLE_PANEL_DOMAINS . "` `d`, `" . TABLE_PANEL_DOMAINS . "` `pd`
|
|
WHERE `d`.`customerid` = :customerid
|
|
AND `d`.`id` = :id
|
|
AND ((`d`.`parentdomainid`!='0'
|
|
AND `pd`.`id` = `d`.`parentdomainid`)
|
|
OR (`d`.`parentdomainid`='0'
|
|
AND `pd`.`id` = `d`.`id`))
|
|
AND `d`.`caneditdomain`='1'");
|
|
$result = Database::pexecute_first($stmt, array("customerid" => $userinfo['customerid'], "id" => $id));
|
|
|
|
$alias_stmt = Database::prepare("SELECT COUNT(`id`) AS count FROM `" . TABLE_PANEL_DOMAINS . "` WHERE `aliasdomain`= :aliasdomain");
|
|
$alias_check = Database::pexecute_first($alias_stmt, array("aliasdomain" => $result['id']));
|
|
$alias_check = $alias_check['count'];
|
|
$_doredirect = false;
|
|
|
|
if(isset($result['customerid']) && $result['customerid'] == $userinfo['customerid']) {
|
|
if(isset($_POST['send']) && $_POST['send'] == 'send') {
|
|
if(isset($_POST['url']) && $_POST['url'] != '' && validateUrl($idna_convert->encode($_POST['url']))) {
|
|
$path = $_POST['url'];
|
|
$_doredirect = true;
|
|
} else {
|
|
$path = validate($_POST['path'], 'path');
|
|
}
|
|
|
|
if(!preg_match('/^https?\:\/\//', $path) || !validateUrl($idna_convert->encode($path))) {
|
|
// If path is empty or '/' and 'Use domain name as default value for DocumentRoot path' is enabled in settings,
|
|
// set default path to subdomain or domain name
|
|
if((($path == '') || ($path == '/')) && $settings['system']['documentroot_use_default_value'] == 1) {
|
|
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $result['domain']);
|
|
} else {
|
|
$path = makeCorrectDir($userinfo['documentroot'] . '/' . $path);
|
|
}
|
|
if (strstr($path, ":") !== FALSE) {
|
|
standard_error('pathmaynotcontaincolon');
|
|
}
|
|
} else {
|
|
$_doredirect = true;
|
|
}
|
|
|
|
$aliasdomain = intval($_POST['alias']);
|
|
|
|
if(isset($_POST['selectserveralias']) && $result['parentdomainid'] == '0' ) {
|
|
$iswildcarddomain = ($_POST['selectserveralias'] == '0') ? '1' : '0';
|
|
$wwwserveralias = ($_POST['selectserveralias'] == '1') ? '1' : '0';
|
|
} else {
|
|
$iswildcarddomain = '0';
|
|
$wwwserveralias = '0';
|
|
}
|
|
|
|
if($result['parentdomainid'] != '0' && ($result['subcanemaildomain'] == '1' || $result['subcanemaildomain'] == '2') && isset($_POST['isemaildomain'])) {
|
|
$isemaildomain = intval($_POST['isemaildomain']);
|
|
} else {
|
|
$isemaildomain = $result['isemaildomain'];
|
|
}
|
|
|
|
$aliasdomain_check = array('id' => 0);
|
|
|
|
if($aliasdomain != 0) {
|
|
$aliasdomain_stmt = Database::prepare("SELECT `id` FROM `" . TABLE_PANEL_DOMAINS . "` `d`,`" . TABLE_PANEL_CUSTOMERS . "` `c`
|
|
WHERE `d`.`customerid`= :customerid
|
|
AND `d`.`aliasdomain` IS NULL
|
|
AND `d`.`id`<>`c`.`standardsubdomain`
|
|
AND `c`.`customerid`= :customerid
|
|
AND `d`.`id`= :id"
|
|
);
|
|
$aliasdomain_check = Database::pexecute_first($aliasdomain_stmt, array("customerid" => $result['customerid'], "id" => $aliasdomain));
|
|
}
|
|
|
|
if($aliasdomain_check['id'] != $aliasdomain) {
|
|
standard_error('domainisaliasorothercustomer');
|
|
}
|
|
|
|
if(isset($_POST['openbasedir_path']) && $_POST['openbasedir_path'] == '1') {
|
|
$openbasedir_path = '1';
|
|
} else {
|
|
$openbasedir_path = '0';
|
|
}
|
|
|
|
if (isset($_POST['ssl_redirect']) && $_POST['ssl_redirect'] == '1') {
|
|
// a ssl-redirect only works of there actually is a
|
|
// ssl ip/port assigned to the domain
|
|
if (domainHasSslIpPort($id) == true) {
|
|
$ssl_redirect = '1';
|
|
} else {
|
|
standard_error('sslredirectonlypossiblewithsslipport');
|
|
}
|
|
} else {
|
|
$ssl_redirect = '0';
|
|
}
|
|
|
|
if($path == '') {
|
|
standard_error('patherror');
|
|
} else {
|
|
if(($result['isemaildomain'] == '1') && ($isemaildomain == '0')) {
|
|
$params = array("customerid" => $userinfo['customerid'], "domainid" => $id);
|
|
$stmt = Database::prepare("DELETE FROM `" . TABLE_MAIL_USERS . "` WHERE `customerid`= :customerid AND `domainid`= :domainid");
|
|
Database::pexecute($stmt, $params);
|
|
$stmt = Database::prepare("DELETE FROM `" . TABLE_MAIL_VIRTUAL . "` WHERE `customerid`= :customerid AND `domainid`= :domainid");
|
|
Database::pexecute($stmt, $params);
|
|
$log->logAction(USR_ACTION, LOG_NOTICE, "automatically deleted mail-table entries for '" . $idna_convert->decode($result['domain']) . "'");
|
|
}
|
|
|
|
if($_doredirect) {
|
|
$redirect = isset($_POST['redirectcode']) ? (int)$_POST['redirectcode'] : false;
|
|
updateRedirectOfDomain($id, $redirect);
|
|
}
|
|
|
|
if($path != $result['documentroot']
|
|
|| $isemaildomain != $result['isemaildomain']
|
|
|| $wwwserveralias != $result['wwwserveralias']
|
|
|| $iswildcarddomain != $result['iswildcarddomain']
|
|
|| $aliasdomain != $result['aliasdomain']
|
|
|| $openbasedir_path != $result['openbasedir_path']
|
|
|| $ssl_redirect != $result['ssl_redirect']) {
|
|
$log->logAction(USR_ACTION, LOG_INFO, "edited domain '" . $idna_convert->decode($result['domain']) . "'");
|
|
|
|
$stmt = Database::prepare("UPDATE `" . TABLE_PANEL_DOMAINS . "` SET
|
|
`documentroot`= :documentroot,
|
|
`isemaildomain`= :isemaildomain,
|
|
`wwwserveralias`= :wwwserveralias,
|
|
`iswildcarddomain`= :iswildcarddomain,
|
|
`aliasdomain`= :aliasdomain,
|
|
`openbasedir_path`= :openbasedir_path,
|
|
`ssl_redirect`= :ssl_redirect
|
|
WHERE `customerid`= :customerid
|
|
AND `id`= :id"
|
|
);
|
|
$params = array(
|
|
"documentroot" => $path,
|
|
"isemaildomain" => $isemaildomain,
|
|
"wwwserveralias" => $wwwserveralias,
|
|
"iswildcarddomain" => $iswildcarddomain,
|
|
"aliasdomain" => ($aliasdomain != 0 && $alias_check == 0) ? $aliasdomain : null,
|
|
"openbasedir_path" => $openbasedir_path,
|
|
"ssl_redirect" => $ssl_redirect,
|
|
"customerid" => $userinfo['customerid'],
|
|
"id" => $id
|
|
);
|
|
Database::pexecute($stmt, $params);
|
|
inserttask('1');
|
|
|
|
// Using nameserver, insert a task which rebuilds the server config
|
|
inserttask('4');
|
|
|
|
}
|
|
|
|
redirectTo($filename, Array('page' => $page, 's' => $s));
|
|
}
|
|
} else {
|
|
$result['domain'] = $idna_convert->decode($result['domain']);
|
|
|
|
$domains = makeoption($lng['domains']['noaliasdomain'], 0, $result['aliasdomain'], true);
|
|
// also check ip/port combination to be the same, #176
|
|
$domains_stmt = Database::prepare("SELECT `d`.`id`, `d`.`domain` FROM `" . TABLE_PANEL_DOMAINS . "` `d` , `" . TABLE_PANEL_CUSTOMERS . "` `c` , `".TABLE_DOMAINTOIP."` `dip`
|
|
WHERE `d`.`aliasdomain` IS NULL
|
|
AND `d`.`id` <> :id
|
|
AND `c`.`standardsubdomain` <> `d`.`id`
|
|
AND `d`.`customerid` = :customerid
|
|
AND `c`.`customerid` = `d`.`customerid`
|
|
AND `d`.`id` = `dip`.`id_domain`
|
|
AND `dip`.`id_ipandports`
|
|
IN (SELECT `id_ipandports` FROM `".TABLE_DOMAINTOIP."`
|
|
WHERE `id_domain` = :id)
|
|
GROUP BY `d`.`domain`
|
|
ORDER BY `d`.`domain` ASC"
|
|
);
|
|
Database::pexecute($domains_stmt, array("id" => $result['id'], "customerid" => $userinfo['customerid']));
|
|
|
|
while($row_domain = $domains_stmt->fetch(PDO::FETCH_ASSOC)) {
|
|
$domains .= makeoption($idna_convert->decode($row_domain['domain']), $row_domain['id'], $result['aliasdomain']);
|
|
}
|
|
|
|
if(preg_match('/^https?\:\/\//', $result['documentroot']) && validateUrl($idna_convert->encode($result['documentroot']))) {
|
|
if($settings['panel']['pathedit'] == 'Dropdown') {
|
|
$urlvalue = $result['documentroot'];
|
|
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit']);
|
|
} else {
|
|
$urlvalue = '';
|
|
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot'], true);
|
|
}
|
|
} else {
|
|
$urlvalue = '';
|
|
$pathSelect = makePathfield($userinfo['documentroot'], $userinfo['guid'], $userinfo['guid'], $settings['panel']['pathedit'], $result['documentroot']);
|
|
}
|
|
|
|
$redirectcode = '';
|
|
if($settings['customredirect']['enabled'] == '1') {
|
|
$def_code = getDomainRedirectId($id);
|
|
$codes = getRedirectCodesArray();
|
|
foreach($codes as $rc) {
|
|
$redirectcode .= makeoption($rc['code']. ' ('.$lng['redirect_desc'][$rc['desc']].')', $rc['id'], $def_code);
|
|
}
|
|
}
|
|
|
|
// check if we at least have one ssl-ip/port, #1179
|
|
$ssl_ipsandports = '';
|
|
$ssl_ip_stmt = Database::prepare("SELECT COUNT(*) as countSSL FROM `panel_ipsandports` WHERE `ssl`='1'");
|
|
Database::pexecute($ssl_ip_stmt);
|
|
$resultX = $ssl_ip_stmt->fetch(PDO::FETCH_ASSOC);
|
|
if (isset($resultX['countSSL']) && (int)$resultX['countSSL'] > 0) {
|
|
$ssl_ipsandports = 'notempty';
|
|
}
|
|
|
|
$openbasedir = makeoption($lng['domain']['docroot'], 0, $result['openbasedir_path'], true) . makeoption($lng['domain']['homedir'], 1, $result['openbasedir_path'], true);
|
|
|
|
// create serveralias options
|
|
$serveraliasoptions = "";
|
|
$_value = '2';
|
|
if ($result['iswildcarddomain'] == '1') {
|
|
$_value = '0';
|
|
} elseif ($result['wwwserveralias'] == '1') {
|
|
$_value = '1';
|
|
}
|
|
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_wildcard'], '0', $_value, true, true);
|
|
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_www'], '1', $_value, true, true);
|
|
$serveraliasoptions .= makeoption($lng['domains']['serveraliasoption_none'], '2', $_value, true, true);
|
|
|
|
$ips_stmt = Database::prepare("SELECT `p`.`ip` AS `ip` FROM `".TABLE_PANEL_IPSANDPORTS."` `p`
|
|
LEFT JOIN `".TABLE_DOMAINTOIP."` `dip`
|
|
ON ( `dip`.`id_ipandports` = `p`.`id` )
|
|
WHERE `dip`.`id_domain` = :id_domain
|
|
GROUP BY `p`.`ip`"
|
|
);
|
|
Database::pexecute($ips_stmt, array("id_domain" => $result['id']));
|
|
$result_ipandport['ip'] = '';
|
|
while ($rowip = $ips_stmt->fetch(PDO::FETCH_ASSOC)) {
|
|
$result_ipandport['ip'] .= $rowip['ip'] . "<br />";
|
|
}
|
|
|
|
$domainip = $result_ipandport['ip'];
|
|
$result = htmlentities_array($result);
|
|
|
|
$subdomain_edit_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domains_edit.php';
|
|
$subdomain_edit_form = htmlform::genHTMLForm($subdomain_edit_data);
|
|
|
|
$title = $subdomain_edit_data['domain_edit']['title'];
|
|
$image = $subdomain_edit_data['domain_edit']['image'];
|
|
|
|
eval("echo \"" . getTemplate("domains/domains_edit") . "\";");
|
|
}
|
|
} else {
|
|
standard_error('domains_canteditdomain');
|
|
}
|
|
}
|
|
} elseif ($page == 'domainssleditor') {
|
|
|
|
if ($action == '' || $action == 'view') {
|
|
if (isset($_POST['send']) && $_POST['send'] == 'send') {
|
|
|
|
$ssl_cert_file = isset($_POST['ssl_cert_file']) ? $_POST['ssl_cert_file'] : '';
|
|
$ssl_key_file = isset($_POST['ssl_key_file']) ? $_POST['ssl_key_file'] : '';
|
|
$ssl_ca_file = isset($_POST['ssl_ca_file']) ? $_POST['ssl_ca_file'] : '';
|
|
$ssl_cert_chainfile = isset($_POST['ssl_cert_chainfile']) ? $_POST['ssl_cert_chainfile'] : '';
|
|
$do_insert = isset($_POST['do_insert']) ? (($_POST['do_insert'] == 1) ? true : false) : false;
|
|
|
|
if ($ssl_cert_file != '' && $ssl_key_file == '') {
|
|
standard_error('sslcertificateismissingprivatekey');
|
|
}
|
|
|
|
$do_verify = true;
|
|
|
|
// no cert-file given -> forget everything
|
|
if ($ssl_cert_file == '') {
|
|
$ssl_key_file = '';
|
|
$ssl_ca_file = '';
|
|
$ssl_cert_chainfile = '';
|
|
$do_verify = false;
|
|
}
|
|
|
|
// verify certificate content
|
|
if ($do_verify) {
|
|
// array openssl_x509_parse ( mixed $x509cert [, bool $shortnames = true ] )
|
|
// openssl_x509_parse() returns information about the supplied x509cert, including fields such as
|
|
// subject name, issuer name, purposes, valid from and valid to dates etc.
|
|
$cert_content = openssl_x509_parse($ssl_cert_file);
|
|
|
|
if (is_array($cert_content) && isset($cert_content['subject']) && isset($cert_content['subject']['CN'])) {
|
|
// bool openssl_x509_check_private_key ( mixed $cert , mixed $key )
|
|
// Checks whether the given key is the private key that corresponds to cert.
|
|
if (openssl_x509_check_private_key($ssl_cert_file, $ssl_key_file) === false) {
|
|
standard_error('sslcertificateinvalidcertkeypair');
|
|
}
|
|
|
|
// check optional stuff
|
|
if ($ssl_ca_file != '') {
|
|
$ca_content = openssl_x509_parse($ssl_ca_file);
|
|
if (!is_array($ca_content)) {
|
|
// invalid
|
|
standard_error('sslcertificateinvalidca');
|
|
}
|
|
}
|
|
if ($ssl_cert_chainfile != '') {
|
|
$chain_content = openssl_x509_parse($ssl_cert_chainfile);
|
|
if (!is_array($chain_content)) {
|
|
// invalid
|
|
standard_error('sslcertificateinvalidchain');
|
|
}
|
|
}
|
|
} else {
|
|
standard_error('sslcertificateinvalidcert');
|
|
}
|
|
}
|
|
|
|
// Add/Update database entry
|
|
$qrystart = "UPDATE ";
|
|
$qrywhere = "WHERE ";
|
|
if ($do_insert) {
|
|
$qrystart = "INSERT INTO ";
|
|
$qrywhere = ", ";
|
|
}
|
|
$stmt = Database::prepare($qrystart." `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."` SET
|
|
`ssl_cert_file` = :ssl_cert_file,
|
|
`ssl_key_file` = :ssl_key_file,
|
|
`ssl_ca_file` = :ssl_ca_file,
|
|
`ssl_cert_chainfile` = :ssl_cert_chainfile
|
|
".$qrywhere." `domainid`= :domainid"
|
|
);
|
|
$params = array(
|
|
"ssl_cert_file" => $ssl_cert_file,
|
|
"ssl_key_file" => $ssl_key_file,
|
|
"ssl_ca_file" => $ssl_ca_file,
|
|
"ssl_cert_chainfile" => $ssl_cert_chainfile,
|
|
"domainid" => $id
|
|
);
|
|
Database::pexecute($stmt, $params);
|
|
|
|
// insert task to re-generate webserver-configs (#1260)
|
|
inserttask('1');
|
|
|
|
// back to domain overview
|
|
redirectTo($filename, array('page' => 'domains', 's' => $s));
|
|
}
|
|
|
|
$stmt = Database::prepare("SELECT * FROM `".TABLE_PANEL_DOMAIN_SSL_SETTINGS."`
|
|
WHERE `domainid`= :domainid"
|
|
);
|
|
Database::pexecute($stmt, array("domainid" => $id));
|
|
$result = $stmt->fetch(PDO::FETCH_ASSOC);
|
|
|
|
$do_insert = false;
|
|
// if no entry can be found, behave like we have empty values
|
|
if (!is_array($result) || !isset($result['ssl_cert_file'])) {
|
|
$result = array(
|
|
'ssl_cert_file' => '',
|
|
'ssl_key_file' => '',
|
|
'ssl_ca_file' => '',
|
|
'ssl_cert_chainfile' => ''
|
|
);
|
|
$do_insert = true;
|
|
}
|
|
|
|
$result = htmlentities_array($result);
|
|
|
|
$ssleditor_data = include_once dirname(__FILE__).'/lib/formfields/customer/domains/formfield.domain_ssleditor.php';
|
|
$ssleditor_form = htmlform::genHTMLForm($ssleditor_data);
|
|
|
|
$title = $ssleditor_data['domain_ssleditor']['title'];
|
|
$image = $ssleditor_data['domain_ssleditor']['image'];
|
|
|
|
eval("echo \"" . getTemplate("domains/domain_ssleditor") . "\";");
|
|
}
|
|
}
|